PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02114.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 421aa    MW: 47674.4 Da    PI: 9.5364
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02114.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-17105151148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT+eEd +l+++v+qlG + W+ I++++  gR +kqc++rw+++l
  Rsa1.0_02114.1_g00004.1 105 KGQWTAEEDRKLIRLVRQLGEKKWAMISEKLE-GRAGKQCRERWHNHL 151
                              799*****************************.*************97 PP

2Myb_DNA-binding49.87.6e-16158199245
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              + W++eE++ lv+ +k+ G++ W+ Ia+ ++ gRt++++k++w+
  Rsa1.0_02114.1_g00004.1 158 DGWSEEEEKVLVETHKRIGNK-WAEIAKLIP-GRTENSIKNHWN 199
                              56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.439100155IPR017930Myb domain
SuperFamilySSF466894.67E-29102198IPR009057Homeodomain-like
SMARTSM007171.5E-15104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-26106159IPR009057Homeodomain-like
CDDcd001672.08E-14108151No hitNo description
PfamPF139212.7E-18108166No hitNo description
SMARTSM007177.5E-13156204IPR001005SANT/Myb domain
PROSITE profilePS5129417.581156206IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-19160204IPR009057Homeodomain-like
CDDcd001674.83E-10160202No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MEHRRLVHGA APPLTSVERF LYGQKNDTLY PKKQDCSRDR HPAIMKKTKA IETKNDNKEN  60
LTFGPRKDKH LVANGGISIG DMVAKDATRG YHNPTKKRPF KNLIKGQWTA EEDRKLIRLV  120
RQLGEKKWAM ISEKLEGRAG KQCRERWHNH LRPDIKKDGW SEEEEKVLVE THKRIGNKWA  180
EIAKLIPGRT ENSIKNHWNA TKRRQNSKRK QKRREANGGN DDSDLSPAAK RPCILQDYIK  240
SIDSNVKNKA NDDNKNENSI SVLTTPNLDQ IYSDGDSTSS ILGDPYDEEL VYLQNIFANH  300
PVSLDNIGLN QTSDEVTMIK NPNSHKSVWT HHQDQAMAAV PENKPHLASD VYLSYLLNGT  360
ASSYSYPHFP SSSSSTSSTT VEQGGHSELL VPQDNSTGER REMDLMEMLS GSIQGSNKCF  420
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-441032052104C-Myb DNA-Binding Domain
1msf_C2e-441032052104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201212KRRQNSKRKQKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126728.10.0PREDICTED: myb-related protein A
TrEMBLM4DV030.0M4DV03_BRARP; Uncharacterized protein
STRINGBra020346.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.10.0myb domain protein 119